DPCstruct | MC19675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 425 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 12.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.42 |
| Pfam Score | 96.04 |
| Assigned Pfam label(s) | CL0014- CL0639- CL0654 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4UR86 | 4-70 | TRKKVERALAEGVLIDITYESAKRVVTERGVLPECVWEEDGREYCLGFCTLRNAERTFRLDRIKEIS |
| A0A7H0VIT7 | 129-216 | PSRNKKEAQLLKIQKAIVEYQILHLKYLDSAGKWSERDVEPLGLYFTVESWVMVAHCRLRQEEREFRVDRIQEILDKDEHFALRPFAL |
| A0A259SXV8 | 1-64 | None |
| A0A0V8GEW7 | 8-85 | None |
| A0A251ZT25 | 87-169 | None |
| A0A1Y2S783 | 90-184 | None |
| A0A1H4DAI3 | 141-233 | None |
| A0A7V2XLN4 | 7-88 | None |
| A0A6L5XQR8 | 131-252 | None |
| A0A4Z1CST1 | 111-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.