DPCstruct | MC19672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 10.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6A5J6 | 2-98 | ERSLKALTLVLALLGATACYHATIDTGRPPSPQTIERPWATSLIYGLVPPPVVETASRCPNGVSRVETQITFLNWLVGQLTLGIYTP… |
| A0A7H0VEA8 | 4-99 | KSLAALVIGSLLLSSCFSHHYSIGKGVRVEKTREVTEKNHFMGFGVIPVKRCHIDQMVGDTLNYEIYTRSTPQDMIVSTLTIGIYTP… |
| A0A382FQD5 | 8-101 | None |
| A0A1G8DBI4 | 2-103 | None |
| A0A1Y5GJZ7 | 2-106 | None |
| A0A3A8FQK7 | 2-102 | None |
| A0A2N0BHG2 | 12-125 | None |
| V6I418 | 1-106 | None |
| A0A2E8PYE2 | 52-171 | None |
| A0A2P1QTM0 | 68-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.