DPCstruct | MC1967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6C563 | 51-135 | VEGTSKVGVYIYENTEIRQAVISRETLKKELATYYDAQGTAYYFGGIGSEDGEYINVENGPFIHFDPLTIEHYNSSKSIEAFIKD |
| A0A7X7H3Q1 | 10-106 | DEADEPNLIEGMTRVDAYIIPNDEALAYIESREAIVVAVTEHFAEKGIPVSREFAGSEDGEALTYTDESGWHFLFHLDPMIVRAWDE… |
| A0A0A0IWI3 | 1-89 | None |
| A0A1H4CFT8 | 4-100 | None |
| A0A8B0GJ56 | 20-112 | None |
| F9N6S5 | 2-109 | None |
| V6Q6S6 | 1-96 | None |
| H3NHJ2 | 92-182 | None |
| A0A3D3CGH9 | 1-99 | None |
| E7FU84 | 201-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.