DPCstruct | MC1966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 167 ± 19 aa |
| Standard deviation of domain lengths | 19.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5EAK8 | 8-156 | AGKRCGVCQAQLPDSNGRWFSAVKETESGFERLEFCGDCFEKADKNGLFSFWKRKVKKGGVKIFFDSEGALQLFHQLLDRSEYAELL… |
| A0A2Z4Y918 | 1-155 | MAEQGKHPSVLVLPSEEGSEGEEEIPQRRDYCPTCWDRLDSRNYVGFWLARRDPPKPRKVQNRKERNARLAAYFDYFYHEDRAAHAA… |
| A0A3L7STK9 | 6-142 | None |
| A0A3M2CMJ2 | 31-192 | None |
| A0A1Z8Y438 | 1-149 | None |
| A0A366HFA8 | 1-177 | None |
| A0A354T9R8 | 7-202 | None |
| A0A7X1AVM7 | 61-229 | None |
| A0A2D5E4L0 | 10-183 | None |
| A0A257QJ39 | 27-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.