DPCstruct | MC19658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 130 ± 21 aa |
| Standard deviation of domain lengths | 20.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 80.65 |
| Assigned Pfam label(s) | CL0229- PF09030- PF02135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024G7N0 | 5-110 | SHEEKFEIYNDALLHASQCAEMAQCTSKRCHKVRASIDHFVRCYGPRRTVSPIESCDACVKIWGLLCYHAKSCSTPIEGHCIVSQCD… |
| A0A0V1K9M3 | 38-158 | MEQMKSINRHVDSNSGEPEAMSTNSRNESIKRCVQSLEHASQCRDANCQRLSCRKLKRVVQHANLCEKRQAGHCPVCKQLVALSCHH… |
| A0A822E9E1 | 2-93 | None |
| A0A7S2RDY8 | 368-527 | None |
| A0A7R9L6Y6 | 63-205 | None |
| A0A6P5G126 | 447-568 | None |
| A0A6P5MYH4 | 75-227 | None |
| A0A2P4YRA1 | 286-426 | None |
| A0A813LVJ4 | 11-146 | None |
| A0A1Y1NAH5 | 139-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.