DPCstruct | MC19657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 335 ± 79 aa |
| Standard deviation of domain lengths | 79.21 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 73.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 82.20 |
| Assigned Pfam label(s) | CL0123- CL0028- CL0033- PF17682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0E5I3 | 75-366 | AQEIESNLVYLECTSDENGFLVILDTFSKIYEFKEPVDFYFPQPLESQAFYKNFHQILLDDNLHNFVKHSDTLNDYLKTKNFPDFFM… |
| A0A0V1JQJ9 | 839-1189 | SRHREGAFLIIRARRLIQASPSSSEQATYSVQLEVVGTLSSIHDFNSSLFDFQYLPMRKNEDGQYSEIYSALVPSTKEQAERWFTAP… |
| I4Y7X9 | 63-392 | None |
| A0A365MK19 | 97-490 | None |
| A0A1P8BB21 | 72-461 | None |
| A0A066VUT5 | 617-966 | None |
| A0A0V0R1V3 | 53-417 | None |
| A0A6A5E172 | 13-312 | None |
| A0A074SF78 | 285-674 | None |
| A0A1Q9E3X8 | 246-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.