DPCstruct | MC19656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 526 ± 84 aa |
| Standard deviation of domain lengths | 84.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 14.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L1S3A9 | 27-434 | DTGLAMLEAGRARANPGPYRAVGDSNTQAVDAAFNIMAPNAPASQFSAALETQRADAIRGATEQVTAAQQAFDNATRGLAPIMTGDG… |
| A0A739C3K6 | 140-533 | LMDIAKRLGFKPTVAVVTQSAPAKITEQVLANTPFSAGVTRQAIADEHEGLAAAFGEMAGESPDSSQLGYDIQEQVKDSIQAIKSDV… |
| A0A2H0NCR1 | 99-782 | None |
| A0A840RWC0 | 1-510 | None |
| A0A7G2RQR4 | 7-490 | None |
| A0A6G8YKN5 | 7-410 | None |
| A0A7U2PZ41 | 1-689 | None |
| A0A1B4LBV0 | 11-451 | None |
| A0A2D6JHL5 | 111-618 | None |
| A0A523VHS2 | 20-640 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.