DPCstruct | MC1965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 192 ± 17 aa |
| Standard deviation of domain lengths | 16.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 13.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7GB74 | 197-368 | RREHIGKERYHLEAINACISSSYEKGTSHVSPENGIHYLAITKFKKGALDQIPLKYARVFNLNEYKTAMNWHPYTPFHLSLNPEHLF… |
| A0A2Z4Y422 | 30-232 | TEGIERWAALRPLYYDFAFEAFEQSQLLLAQVDPQVVLAFIPWNLPDEMAASVMEVLEHEARKLFASSGPHLVYDLSEVANAPMPLD… |
| A0A534I7S1 | 28-205 | None |
| A0A387B7I6 | 262-453 | None |
| A0A2F0ATB2 | 158-369 | None |
| A0A3A0DHI6 | 3-184 | None |
| A0A6G7P9L7 | 178-365 | None |
| A0A6L9QKS7 | 110-305 | None |
| A0A2F0ASW7 | 124-301 | None |
| A9H1U6 | 98-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.