DPCstruct | MC19648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4PU40 | 92-228 | YTQKEKLINPVVFTYLDGEKDPCSTYTYNQCNTDARIEVCEYGSHLALVLTTWINLGPGLTPDDPRWIIHSCSHENRDVTLDPNDCT… |
| A0A1V6NX66 | 32-167 | YDELLSTIEEFVNVYCERRTLPLLRTTCDKCNTEYQLELREYGKDNLAFMITRWINLGPGRSPDDPQWKVHSLGSQDVPFTLGPEHM… |
| A0A1Q5U1L3 | 11-137 | None |
| A0A135LTV8 | 100-227 | None |
| A0A1V6SWC6 | 3-117 | None |
| A0A5N6HJH4 | 185-326 | None |
| A0A2J6RMD3 | 46-183 | None |
| A0A1S9RTA2 | 84-209 | None |
| A0A0G4PA70 | 163-281 | None |
| A0A1V6U3N7 | 4-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.