DPCstruct | MC19647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 221 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6NHF0 | 3-204 | ELLQSKADSLDHDQFDIKSPSDCAVAIKSNTTAVTSEIELQYIIYIAFPYKQLELELMTIAKAFTGAIIENIPRGKTVDFEFFSADQ… |
| A0A395MZQ8 | 3-208 | LPPLTNLCFYFVHPEFNLDNFNFTAFWDDVLARADERLRLEIFCTPGGTDADCAHHYRKELEARGDLLEQVREVERAENDPEYAAAR… |
| A0A6A5THF3 | 293-510 | None |
| R8BGM1 | 1-245 | None |
| A0A1V6THR3 | 3-216 | None |
| A0A101MEV3 | 600-795 | None |
| A0A101MJM5 | 1-216 | None |
| A0A317W8S4 | 1-222 | None |
| A0A1L9VGD1 | 6-207 | None |
| A0A3D8SLD4 | 6-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.