DPCstruct | MC19642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 97 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F9C1Z3 | 163-247 | GFWHSPECEFVRYCIAKSQERVEGKVQVSVFKGQVYILGRESPLSLYNEELVSMNVQGDYEPIDATGFININSLRLKEYHRLQSK |
| A0A7U8U615 | 260-353 | TDQRWAELVYDGLWYSPLKAALEAFVAKTQEHVSGEVRLVLHGGHIAVNGRRSAESLYDFNLATYDEGDSFDQSAARGFVYVHGLSS… |
| A0A2B4S7F2 | 297-409 | None |
| A0A1G3YLS4 | 2-63 | None |
| A0A2L2X9B5 | 2-67 | None |
| A0A7Y5EW81 | 71-162 | None |
| A0A667I390 | 487-595 | None |
| A0A5N5ICM9 | 374-467 | None |
| A0A556TYL1 | 81-186 | None |
| A0A5J5CR08 | 415-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.