DPCstruct | MC19641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L4ALG1 | 3-97 | VLHLLPAIAGYILLSLHFFRADNHPAMMGTLLLIAAMLIRRPIVARLLQVALLIGAVEWVRTAASLVLIRTEMGEPFLRLAIILGAV… |
| A0A7Y4FGU4 | 2-104 | IWRTVLLFLSYWILAAHFLRYDGIFPTAIVASIPLLIIIRHRMVVYLLQAGLLVAVIAVWIPTTINIAQFRISMGDPWLRMSLIMSG… |
| A0A1Y4D3H2 | 4-119 | None |
| A0A7W0EIJ2 | 2-119 | None |
| A0A2E5WGA2 | 1-124 | None |
| A0A7Y2YR90 | 2-98 | None |
| A0A2G6J694 | 68-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.