DPCstruct | MC1964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 202 ± 33 aa |
| Standard deviation of domain lengths | 33.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | PF00137- CL0067- PF00119 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M9NST8 | 36-245 | LLLASLFLIFQHLLYNKEGVLGLGNTLMLCIESLFGFILQLVKNQIGPQGQPYFPAIYSLFLFILFLNLIGLIPYSFTATAHFALTL… |
| A0A2Z4Y146 | 247-466 | EYQIFLVFITIFLCLLIWLTKGLRALLPGPVQAASELIVEGFLNFTASILGSREQARKHFPFVGSLFIFIWANNMFGIVPLFTGATS… |
| A0A445C738 | 194-396 | None |
| A0A7Z0GIK1 | 41-268 | None |
| A0A444X366 | 105-338 | None |
| A0A1H2DX43 | 67-271 | None |
| A0A1X9WD98 | 12-224 | None |
| A0A1J0PP53 | 19-222 | None |
| G4VZQ0 | 21-222 | None |
| A0A538ILD0 | 220-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.