DPCstruct | MC19637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 153 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09688 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8WWT7 | 1-133 | MLNLSNGIHYDPQLNLDVQVVSEEQEDYEEELNELIEQITETWNETFVSMIEDYIDFTEQNDIIDGEWKCQMWNQRWFIYLKLLVRS… |
| Q8I2F8 | 23-189 | DTRQLDSFSSIQKNFLSYDMLIIRNERILSEQHDENDWRNEFSVVINLKNIPEEQQLGEQQEPEYIYELNDLCKRASEYWKNAISDM… |
| A0A1Y1JGB0 | 20-169 | None |
| A0A1C3KJT1 | 88-245 | None |
| A0A1C3KIF5 | 20-169 | None |
| A0A1A9ALG6 | 31-176 | None |
| A0A1G4HIA1 | 91-236 | None |
| A0A024W671 | 131-292 | None |
| A0A0L7KID6 | 32-172 | None |
| Q8IIX2 | 58-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.