DPCstruct | MC19636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 16.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8I234 | 1-97 | MESNKVIKMKNKLNTFEMFMNQYIVKYKNTKECFMCKNKITSNHIEKMENICPKMWKYFHGIINQPQCPLQSFGKVLKVKDLRFEEL… |
| A0A0G4H5H8 | 2-88 | DEVEAFLERRVFKWKATKMCTVCKKEIVRGLVEPVEYSCPTLWRLYHGYVMLKRNCPNQTHVSVVKVSDLRSEERHQVWKMILQHKK |
| A0A2C6KI53 | 207-327 | None |
| A0A2A9ME38 | 251-368 | None |
| A0A7S1KK42 | 10-144 | None |
| A0A0J9SIQ3 | 31-113 | None |
| A0A7J6L3B9 | 40-136 | None |
| A0A7S4RKN4 | 44-160 | None |
| U6L1A3 | 116-240 | None |
| A0A7J6RMQ5 | 4-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.