DPCstruct | MC19635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 133 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5ZBC4 | 1-100 | MQTQYIARTDGRPPLRFQGERLARLDTHWDRGREQTRWWQLEVYRTAAGRYVLVAAYRTAWQGERDEVTADVLDDLGQVPELLEERG… |
| A0A7K0A7V5 | 3-116 | IPVQITLPRYRDKPLVFTGERLAHASSRFDGQDRWTEISIFKTSFEEQRYALHIVGKSSVADEVDLVTTILLHDAAEILETLAREDR… |
| A0A840ACP2 | 10-157 | None |
| A0A257PIK0 | 2-140 | None |
| A0A7V4GDK3 | 1-133 | None |
| A0A1H4AN59 | 206-360 | None |
| A0A6G9QR98 | 147-255 | None |
| A0A1P8WCX5 | 2-128 | None |
| A0A2P5LTQ3 | 6-160 | None |
| A0A5C5X9R8 | 2-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.