DPCstruct | MC19634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 87 ± 13 aa |
| Standard deviation of domain lengths | 12.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1BP48 | 3-89 | FIAMIIQALIERDIRINMEKRDVASIPIYPEERECSYPTSYRILSKFDNIVLNHVLIGGKEIKVIRAELTEIQKQILSLLDIPEDRF |
| A0A1Q7WTG6 | 8-86 | YRLAEFRLRSRLAETQQTIPDQVQKPTVRPTMRWVFQCFEGIELLHVQTAATSLVLVLRLQPVHRLILTFLGPLYEKIY |
| A7BVL1 | 10-87 | None |
| K4LFL6 | 54-140 | None |
| A1ZLF3 | 292-373 | None |
| A0A1Z4V1F4 | 244-322 | None |
| A0A2K8WM01 | 5-78 | None |
| A0A514LE84 | 152-252 | None |
| A0A6M0GEY1 | 171-250 | None |
| A0A3D3YVX3 | 4-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.