DPCstruct | MC19632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 46.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7N9J5 | 99-204 | LPDHGVDQVLFSFYLKNVKPQYQTWSSKKITVVNVFRPVETESFINTRFKVARGATSFVFEFTLADFTYLNPFDWIYLLHLLLKYEQ… |
| A0A6S7P9T8 | 17-148 | QCFEKIEEELISKKALNLNLFNLYLKYAKPQYQTWSLKKIIGVKVCSVVPTEDFTNIRFKGFREKDKVLDEFTLAEFPFMNPFDWIY… |
| A0A6S7MX20 | 100-225 | None |
| A0A6S7N628 | 66-186 | None |
| A0A6S7N6E4 | 2-100 | None |
| A0A6S7N6K1 | 69-165 | None |
| A0A6S7N8E1 | 296-411 | None |
| A0A6S7NBK0 | 88-225 | None |
| A0A6S7NDM5 | 2-117 | None |
| A0A6S7NI49 | 41-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.