DPCstruct | MC19630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 242 ± 26 aa |
| Standard deviation of domain lengths | 26.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 41.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19160 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V4H7Z8 | 20-236 | SAATDPHPATVTASPEWSSAACPLDIPDDLLHDIAAACSPVDSGSDSHSHSHSATLSRCCPSLAASLHAAHAAAALAVLSPASNNGS… |
| A0A6S7P8A1 | 12-251 | SLILMPLLFASPNSEPVQSFHPNSSPPATTIPAFPEQSDATGCPLDLPNDLFTSVKSACTGKHVSGKLRRSRCCPVLAAWLYSAYSA… |
| A0A5N5I5D9 | 1-252 | None |
| A0A2K2D4U3 | 64-284 | None |
| A0A835E6R8 | 5-283 | None |
| A0A426XQK6 | 109-339 | None |
| A0A2U1LDQ3 | 1-204 | None |
| A0A151SVD5 | 1-231 | None |
| A0A287UKF8 | 4-243 | None |
| A0A803R1D5 | 13-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.