DPCstruct | MC1963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 141 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850TE39 | 179-322 | RDENCFTELPRWLTGHGATALLDRFHALVPGWELPRIQSTSLCQSFALRADYFGEVLYALRASQEHMTFIKDHMQSHGDLRDTRAVQ… |
| A0A3M2EMQ6 | 19-141 | FWTRPRGRDTAFLDRIHGLLPGHEFPKITPELLYQGPGLVVDYLAAAFRHLRQKAFPLDLEAPKGYTQRDLRALRKWLSALLKLVYP… |
| E4THI1 | 372-532 | None |
| A0A7J3D536 | 334-472 | None |
| A0A822IWU5 | 325-469 | None |
| V6LCR2 | 182-326 | None |
| A0A3A9BQJ3 | 822-961 | None |
| A0A838VH38 | 230-367 | None |
| A0A564ZHA3 | 24-165 | None |
| A5CYR9 | 25-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.