DPCstruct | MC19625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 3.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847BTC6 | 49-117 | AVADIFEAVTASDRPYKEPNKLSAAMKILYFMAKDGELDKELVKFFYKSGLYLEYAKKWLKKENIDSVN |
| A0A0C4YCL3 | 2-77 | MAIADIFEALTAPDRPYRKAKTLSESIHIMSCMKRDQHIDPDLFELFLVSGVYRDYAAQFMNKERIDNVDIGRCVH |
| A0A011PM38 | 419-494 | None |
| A0A655Q2Y8 | 2-71 | None |
| A0A1X7MKP4 | 1-76 | None |
| A0A2G4IMZ8 | 39-116 | None |
| A0A0H3AF67 | 184-258 | None |
| A0A222FFA9 | 1-82 | None |
| A0A7C7P6D8 | 8-82 | None |
| A0A7C5DLS9 | 67-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.