DPCstruct | MC19624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S4UZW6 | 2-74 | TGFYLRDTRSNVGSTCMFWALNGNGYTSNLDKAHIYTLEDAQRHFNGRHTDVPLSKALVDELTTVLVDHQYLD |
| A0A0C4Y7S5 | 71-158 | HRAPSEAEPAPRQAPSPVESMFYVQDTRQFVGNCVMWWGKNRSGYVTRLNEAGKYTLDEATSICERDTDRMWPCEQIDALAHPTVDMQ |
| A0A1H8ITQ2 | 60-135 | None |
| N9D536 | 2-66 | None |
| A0A0E3BU07 | 228-303 | None |
| A0A5E5A6M1 | 246-326 | None |
| A0A0Q9F8M8 | 161-245 | None |
| A0A2E8JSL4 | 12-93 | None |
| A0A139DP83 | 14-77 | None |
| A0A258ZJL8 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.