DPCstruct | MC19623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838LP18 | 54-117 | VDDVAPVTSFDGCAALNSRFARGVGTVAAVDGMGWDRQLPTVDDRTYEANARLDTDRDGIACER |
| A0A519H569 | 50-120 | TPVAKAKKAKKFKNCTALSKVYKGGVAKPGVKANKVGGKKKPFKVKPTFSKALYTANSHLDRDKDGIACEK |
| A0A7D4UA90 | 2-83 | None |
| A0A0Q5L8T6 | 414-475 | None |
| A0A4Q7DDU5 | 144-205 | None |
| A0A3A3YTZ8 | 47-132 | None |
| A0A6J6P0M9 | 263-329 | None |
| A0A1H9F242 | 330-393 | None |
| K6VIW7 | 54-133 | None |
| A0A1B7KS21 | 17-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.