DPCstruct | MC19622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 321 ± 55 aa |
| Standard deviation of domain lengths | 55.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087BGC4 | 1-225 | MIATVDFSADVCGDHAWKGKNVKISIKDSDNEVIASAVYDFTTKPMKFEDGVTTVKLAFTTNQYWRAVSRIKTSATSMVVQEGSSPN… |
| A0A519H3T9 | 355-656 | TPASVSEAGRVVTKCGRVPTMRPAEYRTDTGGLVVKMEVKASCPDGDIVSTNGMRITVTDHGQTVASAVFDFADAPMYLPSAGTPGP… |
| A0A554V6I1 | 104-436 | None |
| A0A0Y1C3R9 | 10-268 | None |
| A0A448PLR6 | 553-937 | None |
| A0A430FDT1 | 93-447 | None |
| A0A1A0V2N9 | 431-735 | None |
| A0A1H6IK34 | 445-809 | None |
| A0A1M6F640 | 193-572 | None |
| A0A448KBK7 | 418-791 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.