DPCstruct | MC1962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 177 ± 16 aa |
| Standard deviation of domain lengths | 16.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0AGJ3 | 3-163 | THPNKVTIKDESRTVVGMTYLPGTLKVSKDQPFDGDPTIISSGLLFTLEVVAGRHKTSAIANDFNTACGGAAFEYAPNGGGDKPSEL… |
| A0A415HQV0 | 301-465 | ADSHTNAAHIWVKGEGISNVGYVLKEKKITTDQPWNSFHASSSKNNLLTFVVEAGRKGSSDVAEWFIEHSAAGMAGCDTCDAEPDNL… |
| A0A5H2Y2S9 | 136-284 | None |
| A0A1Q9BUW5 | 106-289 | None |
| A0A562EQD5 | 1-149 | None |
| A0A481QBR7 | 21-220 | None |
| A0A7S2VIF7 | 8-163 | None |
| A0A812KQA7 | 52-230 | None |
| A0A0D7AUE6 | 4-200 | None |
| A0A349CW79 | 121-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.