DPCstruct | MC19618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 3.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811QUI5 | 646-727 | LNTLAPQWNEQYTWEVFDPCTIVTVAVFDNGYVRGGGEGSKDQRIGKVRVRLSTLEIDRVYTHIYPLMTLTPGGLKKTGELH |
| A0A835UDI1 | 258-331 | PKWNEQYTWEVYEPCTVVTIGVFDNCQLQSGEKSISARDNIIGKVRIRLSTLESDRVYIHWYPLLVLNNSGVKK |
| A0A6A3C4G1 | 1-69 | None |
| A0A087GZM3 | 900-977 | None |
| A0A4D9AER9 | 186-258 | None |
| A0A2P5XBX0 | 514-587 | None |
| A0A7J0F482 | 301-374 | None |
| A0A2Z6P587 | 330-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.