DPCstruct | MC19614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 165 ± 19 aa |
| Standard deviation of domain lengths | 19.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519TI83 | 1-162 | MLLYLSVKPYTLKFLTRHLGRDYQLSNVDSFGRYLFGLLRQPRNDKQYDNYLSRYTAKFPVRLVPYLLADRACKNCSSQTVVHFNNF… |
| A0A2C9ZU35 | 19-185 | SRKKAQILKFPVKKHLVKYLAAHLGEDYSLSERDQFGALLFHLLRNGLKDCQKDSTMDQYKGRFNVRLSRYPMKQYGLKGMNSNTVF… |
| A0A250FUX2 | 6-138 | None |
| A0A5C7BA73 | 1-170 | None |
| A0A4V2HXM5 | 18-189 | None |
| R5SFG1 | 3-188 | None |
| A0A3B9AJA3 | 1-160 | None |
| A0A1M5G2S7 | 30-234 | None |
| D7JZL6 | 27-202 | None |
| A0A1C2BVH1 | 4-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.