DPCstruct | MC19612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 130 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381CSC4 | 1-135 | MYELACELFPIPRSITGQGFRDSLEILNKTLGGGILKFHSIKSGTKVFDWIVPDEWNAKEAYIITPEGEKICDFKKHNLHLLNYSEA… |
| A0A2T1G8S0 | 220-351 | MYELISKLYPICRSITGDGVRKTLHILQQFIPLELHEVPTGTAVFDWTVPKEWNINDAYIIDPQGQKVIDFHDSNLHVLNYSIPIDT… |
| A0A2D6JTS3 | 20-153 | None |
| A0A7C3FJT3 | 292-431 | None |
| A0A662ZDA7 | 1-111 | None |
| A0A517QW62 | 486-611 | None |
| A0A534AEB7 | 19-149 | None |
| A0A6L3MIJ6 | 566-697 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.