DPCstruct | MC19610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 267 |
|---|---|
| Mean domain length (aa) | 201 ± 41 aa |
| Standard deviation of domain lengths | 41.46 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 77.12 |
| Assigned Pfam label(s) | CL0023- CL0126- CL0671- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5KSF4 | 32-139 | MPSPTAEHEAAHTVAALLTGSCVRKASRIPGPGYSGITELNGFNGVAFMAAHALGCSGTGYDRLVVSQMGHDPDLLAGVARGVLSGH… |
| A0A644XAT3 | 782-989 | GRMAVKQNKPLDDVLLDEAFELSRFGAEKNWGHEYLERVARHESGHAFLCYLGGNTPSYLTIVARGGHGGYMEHSDQDMGPLQTKED… |
| A0A2C9JR48 | 225-482 | None |
| A0A5D3DQY7 | 753-975 | None |
| A0A2E6TF93 | 37-194 | None |
| A0A251T519 | 47-269 | None |
| A0A3S0S6V1 | 140-351 | None |
| A0A6C1RKI5 | 407-625 | None |
| A0A5F1PBK9 | 22-238 | None |
| A0A5D3BAA1 | 16-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.