DPCstruct | MC1961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 18 aa |
| Standard deviation of domain lengths | 17.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8KYV7 | 97-239 | SQDLGKLKQQLQGTDLNSLKQQLDGKDLSGLGALGGGSATSLLGKAISPASSGNVAGLLGYCIKNKYLGAESGAAGLKNKLLGALGG… |
| A0A7H0GP03 | 1-143 | MKKKNHIASSALLCALLVGAAFNAHAAGYGDALKGAMGSAGDSAALSSLGLSGSGTATNAAGVITYCMKNNYLNADKAAAVKDQLLG… |
| A0A3M6QY74 | 80-212 | None |
| A0A6B2FQ82 | 1-160 | None |
| A0A7V8JQP9 | 1-157 | None |
| I2BD49 | 35-203 | None |
| Q2Y5T4 | 46-186 | None |
| A0A4D6X7C6 | 1-112 | None |
| A0A4V4GSD8 | 47-222 | None |
| A0A5C0AVK4 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.