DPCstruct | MC19606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 150 ± 34 aa |
| Standard deviation of domain lengths | 33.93 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376YEJ8 | 2-120 | KIALVIFITLALAGCALLSLHMGVIPVPWRALLTDWQAGREHYYVLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGV… |
| A0A644WRI4 | 8-143 | RRLFFAGLLLLLGGAALWRLLAGDMPLSPAAVADILFSPSPDASPQEILVVRSVRLPRLLASLGAGASLAVSGAVLQGVLGNPLAEP… |
| A0A366DVQ8 | 24-192 | None |
| A0A1C9I020 | 400-590 | None |
| A0A5J4J1K0 | 5-128 | None |
| A0A2X3L2B8 | 293-531 | None |
| A0A6G3VG65 | 16-147 | None |
| A0A380Q885 | 12-144 | None |
| A0A6G3V322 | 4-143 | None |
| A0A6G3VAH5 | 21-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.