DPCstruct | MC19600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 17.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.60 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF09925- PF14345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0VQZ1 | 10-129 | SGKGYLISAIIVAGLQTVILGTIIQSRAAILSNGTEVLLKTAPVDPRDFLRGDYVVLNYDISSVPVQTIAGGIPVKPGELTLWVRLK… |
| A0A2M8LA80 | 10-166 | IMAIVLQLFIVAAIIVFKASVIAGGTTVLFKVEPVDPRDIFRGDYMILSYEDVSRLDRELFKSEKIKRGDNVYAELKQNGRFWEVAR… |
| A4J5K1 | 56-219 | None |
| A0A382F1S6 | 1-164 | None |
| A0A1G0AG39 | 5-173 | None |
| A0A1W1E2A7 | 8-138 | None |
| A0A1C4CXS8 | 19-185 | None |
| A0A3L7PX27 | 489-652 | None |
| A0A7X7LDT2 | 5-175 | None |
| A0A371SL02 | 5-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.