DPCstruct | MC1960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N1XFR7 | 2-100 | RHGNVVWRGEVDGTVDISLRHRTVRATVVSGRSVRREHQHFRVTGFLPARDTVVRLEDVEGQGTVEITQQPDSSNNFTAIVRLANSQ… |
| A0A258AVY1 | 3-122 | ESDSYTDQINLKAIVDFSSVKIQANKLWFVNGPYTVPTKISVMGRKWEPKWPDNVTSEAFTNFKKPLKPFENATIKLSTMSGRGLVQ… |
| A0A517LUR0 | 6-153 | None |
| A0A4Q3WVE6 | 2-128 | None |
| A0A847GF49 | 196-294 | None |
| A0A517VS26 | 240-352 | None |
| A0A661ZTY1 | 64-163 | None |
| A0A831SXW5 | 366-480 | None |
| A0A7X6V794 | 22-158 | None |
| A0A1F2RAC5 | 30-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.