DPCstruct | MC19599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 186 ± 26 aa |
| Standard deviation of domain lengths | 26.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409YXZ0 | 5-207 | MTTVVCHPSAIGIITEMRWASTIDSFYLHQGPLKHFVSPLLIAELLERIQNAQREREGILEDRIRHLSGSNRRLDSILMKSLQDVNG… |
| A0A409WUB3 | 3-170 | LVFLELLDRIQNAMQERQILLDDRFRLLSNPNHILDSTLFHSLRDVDKRLANYLSQLVEFHAPPKHINIHPQYVVYHSFLHIALGSQ… |
| A0A409YB03 | 1-250 | None |
| A0A409YW23 | 198-368 | None |
| A0A409YQG5 | 463-620 | None |
| A0A409WC45 | 164-351 | None |
| A0A409WBU8 | 453-659 | None |
| A0A409WA34 | 19-191 | None |
| A0A409W9P8 | 56-239 | None |
| A0A409WR11 | 251-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.