DPCstruct | MC19597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 391 ± 76 aa |
| Standard deviation of domain lengths | 75.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3JQ48 | 5-301 | QLHITHPTKPLLYVLPPVHLFYSSSPIMGSKVHNWLRIHQWCLIRAINPPLHGKTLMTTPQWRIALDGKYWRVPLDRLGDVHPKSTS… |
| A0A409YMH0 | 62-455 | GRIVTQKHSGFPCICNGKNDIADIVDMIHGYSRRWLTTSNPFDVGPLVTPASSSPPPVQVAEASSSSSRPAKRQKLSGNPTAKGKAQ… |
| A0A0D7ARK7 | 5-256 | None |
| M2R2C9 | 165-487 | None |
| A0A1C7MM22 | 284-824 | None |
| A0A4Y9XLX5 | 253-718 | None |
| A0A6A4GY89 | 4-316 | None |
| A0A4S8MPE9 | 467-914 | None |
| A0A1B7MIT5 | 203-521 | None |
| A0A836DBX3 | 227-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.