DPCstruct | MC19593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 400 ± 98 aa |
| Standard deviation of domain lengths | 98.06 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 66.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0361- CL0163- CL0523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9HMU4 | 1-172 | MGASSLSEGFSEKELVGLIDIICPYCLHALPAQQVFDDREWQNHVINDLDAYICLFEDCDQPDVLYSHSDEWLCHLQQHRRFWRCAS… |
| Q7SBG3 | 40-420 | ASVKDVLGKFMLWAGPQGALRKPESESSLDSRLANSPDLQDCIDFELAVMFEALEDHRLDIDYVRRKHPKLGDGVQSSRMGRAIAMR… |
| A0A4Z0YKC1 | 51-508 | None |
| A0A4Z0YTH5 | 49-474 | None |
| A0A1L9TZ86 | 7-429 | None |
| A0A3N4IEG3 | 172-700 | None |
| A0A3N4IEH1 | 54-576 | None |
| A0A084RL79 | 17-447 | None |
| K2SGB7 | 1-623 | None |
| A0A395H8J5 | 2-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.