DPCstruct | MC19590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413L2Q0 | 3-75 | KSKVWGHTELARLYFPGILPKSASAQLSLWIRRDEELLDDLKKAGYRKGQRMFTPRQVEILVDHLGDPETWNI |
| A0A374TGL5 | 2-73 | QNEPEIRYYTKQEIALLYFPDSSPEVANAHLRRWIQKCTPLYRKLLEVGYRKSDKGFFPRQVAIIFDFLGEP |
| A0A4Y8WNG8 | 112-177 | None |
| E5UUM7 | 24-96 | None |
| R6XGU1 | 18-93 | None |
| A0A0A2DYJ0 | 14-82 | None |
| A0A2X4PNN7 | 15-88 | None |
| R5C1C9 | 5-70 | None |
| A0A255SVD8 | 48-116 | None |
| F3QYR9 | 25-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.