DPCstruct | MC19587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 5 aa |
| Standard deviation of domain lengths | 5.36 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7K8F4 | 59-158 | IPNCILTKEHLCDGLKVLISKEDELLYAARVHTLEIPDIFSIVIDGERGNRPRIYSLEQLLKEAVLDIRPESEAVLSDGTRVCAYWS… |
| A0A1S3GW94 | 1-100 | PRSCIIDKDELKDGLRVLIPMDDKLLYAGHVHTVHSPDIYRVVVEGERGNRPHIYCLEQLLQEAIIDVRPASTRYLPQGTRIAAYWS… |
| A0A183QZ13 | 340-452 | None |
| A0A1A7Y1F1 | 365-461 | None |
| A0A3Q4HZZ7 | 2-97 | None |
| A0A151MHW1 | 462-560 | None |
| A0A0S7GSX2 | 143-234 | None |
| A0A1B0D507 | 231-329 | None |
| A0A4Z2G2Y9 | 36-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.