DPCstruct | MC19584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 222 ± 32 aa |
| Standard deviation of domain lengths | 32.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6JMT5 | 3-190 | QEWILEAVKQDQELLEAPTDVSQSTDVTMCYIQQNLLSILEDISNSLIPNDEAANSFGIKLLLNCTWSINDPTTRNHVFSLLPAVSK… |
| A0A1S3GU85 | 1-283 | GEVSAAHAGPLHRLGNALCSDNTLQAAARFRLFARKSQDVESVQEVGGLYWQRVTLILELLQHKKKLKSPQILIPSLFNLLSRCLEP… |
| A0A438GJC5 | 10-195 | None |
| A0A2G3CVN1 | 640-864 | None |
| A0A835LT43 | 1-231 | None |
| A0A0L0SF41 | 8-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.