DPCstruct | MC19583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 143 ± 29 aa |
| Standard deviation of domain lengths | 29.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.51 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0056- CL0737- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9V5U7 | 2-93 | LRIAALNEPYIGDLQGIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDSIVRAADRELPVVNTRGDVLFNSWKGIFNGQGGFFSQA… |
| A0A1S3GU80 | 324-460 | YPGVPHHHHHSHHSSYMHLRPAHPTSSPAHTHQDFQPVLHLIALNSPLPGGMRGIRGADLQCFQQARAAGLPGTFRAFLSSRLQDLY… |
| A0A3Q2UHG3 | 45-219 | None |
| A0A183NUI7 | 13-161 | None |
| A0A044RG68 | 1149-1328 | None |
| A0A402FH12 | 428-584 | None |
| A0A183HKU7 | 1-97 | None |
| A0A4U5U2L3 | 877-1031 | None |
| A0A5J4NXL9 | 47-168 | None |
| A0A1F8BBK7 | 163-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.