DPCstruct | MC19582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 133 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7J6H9 | 1-117 | MAEAAFNNDIQLKKELDWCITALRKKLRKVNISKNEVKSVINALSVLESKKAPAVKKKIVMRNALGDYRKKMAAEEDGLTKKILDGT… |
| A0A1S3GN10 | 66-202 | AASGKPTRRKAPAGASTDQLAQELAWCVEQLELGLRMQRPTPKQKEQAIGAIRTLRSEKAPLPRKRQLMRSLFGDYRARMEAERQEA… |
| A0A3Q0DRT5 | 207-345 | None |
| A0A210Q2W5 | 6-130 | None |
| A0A3Q3VMG1 | 73-224 | None |
| T1KBB1 | 1-153 | None |
| T1GFC1 | 10-133 | None |
| A0A7M4FQ56 | 1-127 | None |
| A0A7M5UWR1 | 42-174 | None |
| K7FED8 | 3-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.