DPCstruct | MC19581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370H8T2 | 31-131 | LGACAGVRGVMVPVSGSVPGTSTVDMLVATTRERTNPAEMFSGDRGPALAFANITVSIPPDQVRQVGEVQWPRQVPGNPATDFVTLK… |
| A0A0Q6S3T3 | 1-96 | MEPLNLVAEPKGNSVVDMLVATSRLPSDYPTTLFSGERAPQATITDVAVSIPSDRVRASGTVQWPKKLPPNPETDFAVVRVRQLATV… |
| A0A5D9CTF3 | 84-182 | None |
| A0A0Q6GHY2 | 19-110 | None |
| A0A1R3VGB8 | 32-121 | None |
| A0A357MJK4 | 17-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.