DPCstruct | MC1958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 130 ± 15 aa |
| Standard deviation of domain lengths | 15.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6IHF2 | 29-164 | KLIQLQKHRTLVMWALDCAKVPLKQFEAKYPDERRPRICLELCEAWARGKIKMPIAKQAILDSHAVAKEINDSEYAALCHAIGHAGA… |
| A0A7K3YQZ4 | 2-127 | VLWVADCIEHVLALFKEKHPHGNRPQKAIEACRAWVVTGVFKMTLIRRVLFDFHAAARQAKDKLVCFATRAAGHAVAISHVPTHSIG… |
| A0A5D0SQV0 | 22-147 | None |
| A0A554MDY4 | 24-130 | None |
| A0A543I388 | 103-265 | None |
| A0A2S5YGK7 | 2-104 | None |
| A0A1H1EMC4 | 15-125 | None |
| A0A1G3WBC8 | 2-109 | None |
| F0RT60 | 1-125 | None |
| A0A536DGE0 | 13-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.