DPCstruct | MC19578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 76 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7MRT2 | 1-70 | MVDRADLDAVARQLGREPRGVLEIAYRCPNGEPGVVKTAPKLPDGTPFPTLYYLTHPALTAAASRLETTG |
| A0A6H1JME2 | 11-81 | TEPTAADIAAFKQQLGRPPRGLRAIAHRCPCGQPDVVETAPRLEDGTPFPTLYYLTCPRAASAIGTLEANG |
| A0A7C6PTS4 | 13-91 | None |
| A0A316JI44 | 1-69 | None |
| L1II88 | 24-106 | None |
| A0A7V1WDK8 | 3-72 | None |
| F8AVT5 | 21-127 | None |
| A0A101HTL2 | 2-86 | None |
| A0A4D4KY50 | 185-252 | None |
| A0A7G1I884 | 3-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.