DPCstruct | MC19577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 183 ± 32 aa |
| Standard deviation of domain lengths | 32.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6WQG5 | 1-117 | MYRPREVDQAVIAIWITLGLSVAAAIVSKWMSYTSAGDFIFTISVYGLFCLLPFHINRGSNVARWIYSVLAAFSIVLLLGLGLSSLS… |
| E3H1R2 | 2-223 | SQNPYYQDPQYQPSYAQQPQGPYGQPYQPGAYMPVPEKKPEPSTVVKTGIYLIFGYALYTLVSSIYNSVTLRDRMNALLEQQKNQYS… |
| A0A1M5D394 | 1-157 | None |
| A9WLN4 | 66-247 | None |
| A0A7K1UHK5 | 1-204 | None |
| A0A4S8QAC4 | 1-177 | None |
| A0A7W7FQF9 | 197-360 | None |
| A0A4Q2S5M6 | 17-209 | None |
| A0A810KUD0 | 1-176 | None |
| A0A3D5DJN4 | 2-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.