DPCstruct | MC19575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 567 ± 100 aa |
| Standard deviation of domain lengths | 99.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243V4M1 | 1-428 | MVDFSSVNVSSNPGVATLINPQYIASVKHNKGYQSVSFGDGQNSYHIVDRNEHSSSDLHTPRLDKLVTEVAPATVTSSSTADILNPS… |
| A0A2A6D4T2 | 3-539 | LLIMSLMISFNIANASTVSSLIDYQVFRDFAENKGIFKPGTENITIYKKDGSVAGILNKAPMPDFKSVDRSGVATLVNPQYVVSVKH… |
| A0A378NFS1 | 38-695 | None |
| A0A378NJC0 | 18-610 | None |
| A0A378F342 | 1-580 | None |
| I6DI19 | 1-416 | None |
| A0A246W9C2 | 38-501 | None |
| A0A5V1IPY0 | 24-662 | None |
| A0A2X5PFE9 | 2-557 | None |
| A0A656BN70 | 30-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.