DPCstruct | MC1957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 192 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7W7J1 | 2-122 | RQTLEKHYGDKPVGMGGTFVIQKGKVKTHIMPAEFSSCPLKSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFDLRLEHTHCFSHHGE… |
| A0A7J4ADQ1 | 142-276 | IYKFDEIEKIIIVRLRPGSDILPSLEKLCKENNIETAIVLNMIGSLRKASILLPVVKEGNVYYTEPIEFQGPLEFLSGQGFIIKDSE… |
| A0A445BV74 | 16-133 | None |
| Q5AY31 | 574-719 | None |
| A0A7C1EKZ6 | 20-161 | None |
| A0A444Y8K3 | 27-179 | None |
| A0A3D9QRV5 | 304-442 | None |
| A0A7X9SV91 | 173-312 | None |
| A0A6I9KAT4 | 92-250 | None |
| U6KH34 | 110-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.