DPCstruct | MC19569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 193 ± 30 aa |
| Standard deviation of domain lengths | 30.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4Z0I0 | 235-375 | NALNGTRGHALSSAASTKSFCENASSKTKHGSSRNAADGRPSELSTGSHAKRNASDREPSRFCHICQRKQGVVKHIVCCNISQGSCR… |
| A0A7S0ZLM6 | 1-175 | MDNRVRHDLNELFQSHYAELFDLLEPNSVSNCRLNRSPSLESLSHCRSSCEGGSQISGGIKKSRSLSKAERFKKMKARSSKKSKVHS… |
| A0A1X6NL52 | 135-324 | None |
| A0A2V3IT47 | 310-473 | None |
| A0A7S1TEP4 | 479-622 | None |
| A0A7S1TES6 | 1-206 | None |
| A0A5J4Z451 | 25-264 | None |
| A0A5J4YZC7 | 100-334 | None |
| A0A7S0BCE5 | 56-247 | None |
| A0A7S1TIE4 | 49-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.