DPCstruct | MC19567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 181 ± 32 aa |
| Standard deviation of domain lengths | 32.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.13 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0123- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1H7I3 | 29-151 | QEKDGEGEAGAARPKKKSKKVEITQEDYDLMTSMLVSELRAREERQEDDMTQQEVIEWYLLVRDDIDSDEGLIEARKKMQGVIQRLI… |
| A0A7S0ZFR8 | 2-183 | ESLIRLSEAVARLNLSDWIEEMHVKEAANLLDKSILLVEDHDVVLDEEEEEIVREETVEMHEENEENQGLHESEKMSITFGEFRQVV… |
| A0A7R8CW09 | 1-167 | None |
| A0A0B2VZJ9 | 160-357 | None |
| A0A821UNH5 | 395-603 | None |
| A0A1D6FQT6 | 7-213 | None |
| A0A1B0FHJ7 | 430-630 | None |
| A0A2S2R2J9 | 1-129 | None |
| A0A023GKT4 | 90-328 | None |
| A0A3P6QHX2 | 5-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.