DPCstruct | MC19566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 316 ± 61 aa |
| Standard deviation of domain lengths | 61.29 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9NJG4 | 171-442 | ESQRLADLLNRLSLNGLDDSVPVTVTVEGQSAKTPQELVKALMTTGHTVVVADARYFANFGHFHYKGQDVMMPFWVDSQIRVPGTRR… |
| A0A7S0ZDK0 | 1-338 | TPRQECRNRLFAVLLNRIGGANLVVNEPDVLRNHRVKDDESRSEFVVILDERGSIARTASELMEFLVSKPQCNSVCLQIQNQITSFG… |
| A0A560L6L8 | 203-504 | None |
| A0A7S3LM70 | 5-293 | None |
| A0A7S4EHP8 | 109-446 | None |
| A5GUD7 | 189-435 | None |
| A0A1G0ZK23 | 775-1051 | None |
| A0A162BY12 | 4-299 | None |
| L8GWP6 | 206-500 | None |
| A0A5J4YLR9 | 239-710 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.